Jump to content

User:Stevey7788

From Wikipedia, the free encyclopedia
Wikistress level 1 is good for your Wikihealth
Ongoing projects: WikiVocabSwadesh lists

Hello, this is Stevey7788 (talk · contribs)! But you can just call me "Steve". I am a scientist, naturalist, linguist, and Wikipediholic who is eager to document Earth's astounding diversity on Wikipedia as we strive to build the world's largest free online encyclopedia that anyone can edit.

Most of Wikipedia's articles on languages and linguistics were created, expanded, cleaned up, and maintained by me and former admin Kwamikagami. We are to languages as Pvmoutside is to living species.

I'm expanding and improving Wikipedia whenever I can, and have a variety of interests here. Currently, I am particularly interested in the languages of Southeast Asia and Mesoamerica.

Wikipedia is not just one of the best reference tools ever created — it's a great place where everybody can get together, form a community, and write an online encyclopedia together. Although Wikipedia is a great place on the Internet, it's not 100% perfect. But let the encyclopedia writing go on.

Some of Wikipedia's pillars

Some of my current tasks on Wikipedia include:

  • The usual task of reading, writing, and rewriting articles. I do mainly the cleanup, grammar fixes, section moving, racist tone check/cleanup, and other work.
  • RC patroling, sometimes new page patroling
  • Creating redirects and disambiguation pages. Currently, I mainly split or merge pages.
  • Patroling the Sandbox -- raking out content, putting headers back, fishing out offensive content, checking for vandalism
  • Dealing with vandals and warning them
  • Welcoming new users and being part of the Kindness Campaign

Anyways, please feel free to edit or improve my page any way you'd like. I'd really be pleased if someone would help re-organize my page for me. :)

enThis user is a native speaker of the English language.
This user attended Wikimania 2014 in London, United Kingdom.


This user is ranked 1024 on the list of Wikipedians by articles created.
This user is a Wikimaniac.


iconThis user has been editing Wikipedia for more than ten years.
RfAThis user thinks most administrators do a good job but has no wish to join them.


(Excited about Wikimania 2019 in Sweden? Me too. See you there soon!)

Stats

[edit]
We are here to build an encyclopedia. This is my (and our) first and foremost goal. That is why we are here as Wikipedians. Everything else is secondary.

As of August 2005, my total edits amounted to approximately 4500 edits. [1]

I am an early Wikipedian. My first edit was on 07:17 UTC, 13 February 2005. As of 15 October 2005, I was ranked #709 in terms of total number of edits.

May 2019:

June 2018:

February 2018:

December 2017:

January 2017:

What I've done on Wikipedia

[edit]

A lot to do, and more to do. All voluntary and often when I'm bored.

Contributions list

[edit]

Used to be mainly minor edits and tedious work. Due to the images I have uploaded recently, you may see my contributions list clogged up with uploaded images.

Before April 2005, redirects were marked as minor edits.

A few examples of the work I've done on Wikipedia

[edit]

As of now I'm doing lots of work on linguistics and languages.

Redirects are cheap, fun, and
easier than votes for deletion!

Other stuff I had done:

  • Massive stub-sorting
  • Patroling the Sandbox
  • Welcoming new users
  • Warning vandals
  • The map project

Stevey7788's map project

[edit]

The big map project some of you noticed I have launched on Wikipedia:

Awards

[edit]
The Original Barnstar
Thank You for editing Kra–Dai languages Jkrn111 (talk) 13:54, 3 June 2018 (UTC)

I, FP, in my official capacity as nobody-in-particular, hereby bestow upon you, Stevey7788, the mighty and presigious Atlas Award for your dedicated and ongoing work to ensure that one of Wikipedia's most visible pages — the Sandbox — is sanitary, inoffensive, tidy and welcoming to new Wikipedians.

"The Atlas Award For Raking the Sandbox Clean may be awarded to those who have gone above and beyond the call of duty in fishing disgusting and unwanted items from the Wikipedia sandbox. The Atlas award is named after Charles Atlas and is taken from his 'they kicked sand in my face' advertisement, and is in no way merely a masculine image. It is a symbol of self-empowerment. Charles Atlas was once a self-styled 98-pound weakling, and through his own diligence and effort, became a very succesful businessman and body builder. And his business empire began with the ad that this image is from."

Well done. -- FP <talk><edits> 06:44, May 12, 2005 (UTC)

The Asian Month Barnstar
Thanks for your great contribution in Wikipedia Asian Month 2015! --AddisWang (talk) 19:50, 17 December 2015 (UTC)
The Rosetta Barnstar
For all your work in the area of South East Asian linguistics. Donald Trung (Talk) (Articles) Respect mobile users. 23:25, 13 February 2018 (UTC)

My beginnings on Wikipedia

[edit]

Even though I wasn't ever welcomed, I was welcoming others later!

As a newbie on Wiki, I was amused when somebody wrote a short autobiography on my user page: All about Steve the Vandal

Stevey7788 on Wiktionary

[edit]
Wikipedia's lexical companion

I am also a very active Wiktionarian. Lexical companions to online encyclopedias can really be quite fun.

Toolbox

[edit]

This is a toolbox containing various resources and links. Please improve and expand it for me if you'd like to — this is not a "no-edit" zone.

Useful links:

ADMINISTRATORS
GUIDELISTDISPUTEVFDRCCSDDELBLKIFDRFDVPCLEANNEWRFAREFPNAMWAREQ[2]

Current time:

Current time: Sunday, June 28, 2026, 04:28 (UTC) Current week: 26 Number of articles on English Wikipedia: 7,202,209

Odds and ends

[edit]

Proposed Wikipedia mascot:

Go boy! Edit boy!

Boxes

This user is a member of WikiProject Endangered Languages.
This user is ranked 2130 on the list of Wikipedians by articles created.


Released into public domain
I agree to release my text and image contributions, unless otherwise stated, into the public domain. Please be aware that other contributors might not do the same, so if you want to use my contributions under public domain terms, please check the multi-licensing guide.
This user enjoys reading anything.